PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc03741.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 246aa    MW: 25718.6 Da    PI: 9.4505
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc03741.1.g00010.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.8e-381774562
                        zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                  +l+cprCdstntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  Zjn_sc03741.1.g00010.1.am.mk 17 TLRCPRCDSTNTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 74
                                  679***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-30166IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3851872IPR003851Zinc finger, Dof-type
PfamPF027015.6E-321872IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102056IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MAERARLARV PLPEPGTLRC PRCDSTNTKF CYFNNYSLSQ PRHFCKACRR YWTRGGALRN  60
VPVGGGCRRN TKRSSKKSSR QGGVAAAGGA TAASSSSSTT STSTTATTTT TSSAAAAEVL  120
ASMQAQLPQF GLPPAAAAAA LEASLEGYQY HHYLPLQMQQ QFLQQGLQGY HFADGDSGGV  180
FADGFPRGVA SGLLAQLAAV KMEEHNNGGA VAAHEQSYWP SSGGGGNGWP TEFLPGFSSS  240
SSGNVV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008674323.11e-101PREDICTED: dof zinc finger protein DOF5.1-like
TrEMBLA0A0A9I8791e-104A0A0A9I879_ARUDO; Uncharacterized protein
STRINGGRMZM2G176063_P011e-100(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.17e-38Dof family protein